(data stored in SCRATCH zone)

EMBL: AL009126.LYXE

AL009126.LYXE        Location/Qualifiers
FT   CDS             472585..473088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lyxE"
FT                   /locus_tag="BSU_04200"
FT                   /old_locus_tag="BSU04200"
FT                   /product="D-lyxose ketol isomerase"
FT                   /EC_number="5.3.1.15"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10220166, 15805528, 21421786,
FT                   21520290; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12227"
FT                   /db_xref="GOA:P96578"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2Y0O"
FT                   /db_xref="SubtiList:BG12053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96578"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10220166, 15805528, 21421786, 21520290"
FT                   /protein_id="CAB12227.1"
FT                   /translation="MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLF
FT                   VYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPK
FT                   VLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFT
FT                   DPRI"
     MGITKEEVNS YYQKAGIVLT DEEVDQIQLM DYGLGKERKV GLQLFVYVNT DRYCSKELVL        60
     FPGQTCPEHR HPPVDGQEGK QETFRCRYGK VYLYVEGEKT PLPKVLPPQE DREHYTVWHE       120
     IELEPGGQYT IPPNTKHWFQ AGEEGAVVTE MSSTSTDKHD IFTDPRI                     167
//

If you have problems or comments...

PBIL Back to PBIL home page