(data stored in SCRATCH zone)

EMBL: AL009126.MAPA

AL009126.MAPA        Location/Qualifiers
FT   CDS             146527..147273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mapA"
FT                   /locus_tag="BSU_01380"
FT                   /old_locus_tag="BSU01380"
FT                   /product="methionine aminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.18"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16207374, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11914"
FT                   /db_xref="GOA:P19994"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="SubtiList:BG10447"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19994"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16207374, 22720735"
FT                   /protein_id="CAB11914.1"
FT                   /translation="MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAE
FT                   RFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITETGFDILTRV"
     MIICKTPREL GIMREAGRIV ALTHEELKKH IKPGISTKEL DQIAERFIKK QGAIPSFKGY        60
     NGFRGSICVS VNEELVHGIP GSRVLKDGDI ISIDIGAKLN GYHGDSAWTY PVGNISDDDK       120
     KLLEVTEESL YKGLQEAKPG ERLSNISHAI QTYVENEQFS VVREYVGHGV GQDLHEDPQI       180
     PHYGPPNKGP RLKPGMVLAI EPMVNAGSRY VKTLADNWTV VTVDGKKCAH FEHTIAITET       240
     GFDILTRV                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page