(data stored in SCRATCH zone)

EMBL: AL009126.MCSA

AL009126.MCSA        Location/Qualifiers
FT   CDS             101927..102484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BSU_00840"
FT                   /old_locus_tag="BSU00840"
FT                   /product="activator of protein kinase McsB"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 19189946, 24947607;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11860"
FT                   /db_xref="GOA:P37569"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="SubtiList:BG10146"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37569"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 19189946, 24947607"
FT                   /protein_id="CAB11860.1"
FT                   /translation="MICQECHERPATFHFTKVVNGEKIEVHICEQCAKENSDSYGISAN
FT                   QGFSIHNLLSGLLNMDSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGRFGCSECYK
FT                   TFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAH
FT                   VRDQIRLLEQSLKSTDSEEEQE"
     MICQECHERP ATFHFTKVVN GEKIEVHICE QCAKENSDSY GISANQGFSI HNLLSGLLNM        60
     DSSFQNAGTQ MFSHSEQISA CPKCGMTFQQ FRKIGRFGCS ECYKTFHSNI TPILRKVHSG       120
     NTVHAGKIPK RIGGNLHVRR QIDMLKKELE SLIHQEEFEN AAHVRDQIRL LEQSLKSTDS       180
     EEEQE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page