(data stored in SCRATCH zone)

EMBL: AL009126.MCSB

AL009126.MCSB        Location/Qualifiers
FT   CDS             102484..103575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BSU_00850"
FT                   /old_locus_tag="BSU00850"
FT                   /product="protein arginine kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.3.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 17380125, 19189946,
FT                   21622759, 25610436, 27749819; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11861"
FT                   /db_xref="GOA:P37570"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="SubtiList:BG10147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37570"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 17380125, 19189946, 21622759, 25610436,
FT                   27749819"
FT                   /protein_id="CAB11861.1"
FT                   /translation="MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRY
FT                   SNEEASSIIQQFEDQFSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTESPFG
FT                   GCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQ
FT                   ISNQITLGKSEQDIVEDLNSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCR
FT                   MIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLHLEMNGKRQEDESI"
     MSLKHFIQDA LSSWMKQKGP ESDIVLSSRI RLARNFEHIR FPTRYSNEEA SSIIQQFEDQ        60
     FSEQEIPGIG KFVLIRMNDA QPLEKRVLVE KHLISPNLTE SPFGGCLLSE NEEVSVMLNE       120
     EDHIRIQCLF PGFQLLEAMK AANQVDDWIE EKVDYAFNEQ RGYLTSCPTN VGTGLRASVM       180
     MHLPALVLTR QINRIIPAIN QLGLVVRGIY GEGSEAVGNI FQISNQITLG KSEQDIVEDL       240
     NSVAAQLIEQ ERSAREAIYQ TSKIELEDRV YRSYGVLSNC RMIESKETAK CLSDVRLGID       300
     LGIIKGLSSN ILNELMILTQ PGFLQQYSGG ALRPNERDIR RAALIRERLH LEMNGKRQED       360
     ESI                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page