(data stored in SCRATCH zone)

EMBL: AL009126.METS

AL009126.METS        Location/Qualifiers
FT   CDS             45633..47627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BSU_00380"
FT                   /old_locus_tag="BSU00380"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11233169, 12682299, 12792655;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11814"
FT                   /db_xref="GOA:P37465"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="SubtiList:BG10101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37465"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11814.1"
FT                   /translation="MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFD
FT                   VRYLTGTDEHGQKIQQKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHK
FT                   VVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGVKVPENPKHVVYVWIDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHT
FT                   LTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRS
FT                   VMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGE
FT                   PLFPRLEAEEEIAYIKGKMQGSAPAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVI
FT                   EAEPVKKADRLLKLQLDLGFEKRQVVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELS
FT                   QGMILAGEADGVLKVVSIDQSLPKGTRIK"
     MPQENNTFYI TTPIYYPSGK LHIGHAYTTV AGDAMARYKR LKGFDVRYLT GTDEHGQKIQ        60
     QKAEQENITP QEYVDRAAAD IQKLWKQLEI SNDDFIRTTE KRHKVVIEKV FQKLLDNGDI       120
     YLDEYEGWYS IPDETFYTET QLVDIERNEK GEVIGGKSPD SGHPVELIKE ESYFFRMGKY       180
     ADRLLKYYEE NPTFIQPESR KNEMINNFIK PGLEDLAVSR TTFDWGVKVP ENPKHVVYVW       240
     IDALFNYLTA LGYDTENDEL YQKYWPADVH LVGKEIVRFH TIYWPIMLMA LDLPLPKQVF       300
     AHGWLLMKDG KMSKSKGNVV DPVTLIERYG LDELRYYLLR EVPFGSDGVF TPEGFVERIN       360
     YDLANDLGNL LNRTVAMINK YFDGQIGSYK GAVTEFDHTL TSVAEETVKA YEKAMENMEF       420
     SVALSTLWQL ISRTNKYIDE TAPWVLAKDP AKEEELRSVM YHLAESLRIS AVLLQPFLTK       480
     TPEKMFEQLG ITDESLKAWD SITAFGQLKD TKVQKGEPLF PRLEAEEEIA YIKGKMQGSA       540
     PAKEETKEEE PQEVDRLPEI TIDQFMDVEL RVAEVIEAEP VKKADRLLKL QLDLGFEKRQ       600
     VVSGIAKHYT PEELVGKKLV CVTNLKPVKL RGELSQGMIL AGEADGVLKV VSIDQSLPKG       660
     TRIK                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page