(data stored in SCRATCH zone)

EMBL: AL009126.MPR

AL009126.MPR         Location/Qualifiers
FT   CDS             245190..246131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="BSU_02240"
FT                   /old_locus_tag="BSU02240"
FT                   /product="extracellular glutamyl-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 15205417, 15375126, 21819557,
FT                   25666135; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12018"
FT                   /db_xref="GOA:P39790"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="SubtiList:BG10690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39790"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12018.1"
FT                   /translation="MKLVPRFRKQWFAYLTVLCLALAAAVSFGVPAKAAENPQTSVSNT
FT                   GKEADATKNQTSKADQVSAPYEGTGKTSKSLYGGQTELEKNIQTLQPSSIIGTDERTRI
FT                   SSTTSFPYRATVQLSIKYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASTITAAP
FT                   GRNGSSYPYGTYSGTMFYSVKGWTESKDTNYDYGAIKLNGSPGNTVGWYGYRTTNSSSP
FT                   VGLSSSVTGFPCDKTFGTMWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQT
FT                   AIAIHTNGGSSYNLGTRVTNDVFNNIQYWANQ"
     MKLVPRFRKQ WFAYLTVLCL ALAAAVSFGV PAKAAENPQT SVSNTGKEAD ATKNQTSKAD        60
     QVSAPYEGTG KTSKSLYGGQ TELEKNIQTL QPSSIIGTDE RTRISSTTSF PYRATVQLSI       120
     KYPNTSSTYG CTGFLVNPNT VVTAGHCVYS QDHGWASTIT AAPGRNGSSY PYGTYSGTMF       180
     YSVKGWTESK DTNYDYGAIK LNGSPGNTVG WYGYRTTNSS SPVGLSSSVT GFPCDKTFGT       240
     MWSDTKPIRS AETYKLTYTT DTYGCQSGSP VYRNYSDTGQ TAIAIHTNGG SSYNLGTRVT       300
     NDVFNNIQYW ANQ                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page