(data stored in SCRATCH zone)

EMBL: AL009126.MRNC

AL009126.MRNC        Location/Qualifiers
FT   CDS             114854..115285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrnC"
FT                   /locus_tag="BSU_00950"
FT                   /old_locus_tag="BSU00950"
FT                   /product="ribonuclease for 23S RNA maturation, mini-RNase
FT                   III"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16014871, 25634891, 27924926;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11871"
FT                   /db_xref="GOA:O31418"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PDB:4OUN"
FT                   /db_xref="SubtiList:BG12702"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31418"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16014871, 25634891, 27924926"
FT                   /protein_id="CAB11871.1"
FT                   /translation="MLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDL
FT                   HKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTA
FT                   FEALLGYLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT"
     MLEFDTIKDS KQLNGLALAY IGDAIFEVYV RHHLLKQGFT KPNDLHKKSS RIVSAKSQAE        60
     ILFFLQNQSF FTEEEEAVLK RGRNAKSGTT PKNTDVQTYR YSTAFEALLG YLFLEKKEER       120
     LSQLVAEAIQ FGTSGRKTNE SAT                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page