(data stored in ACNUC7421 zone)

EMBL: AL009126.MTLA

AL009126.MTLA        Location/Qualifiers
FT   CDS             449724..451160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="BSU_03981"
FT                   /old_locus_tag="BSU03981"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IICB component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03981"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12206"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="SubtiList:BG11215"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAB12206.2"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFEMLINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFVEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGILLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPALILAAIA
FT                   GGASGLLTFTIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEEASELSPESVNKIIFACDAG
FT                   MGSSAMGASILRNKVKKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHI
FT                   SVDNFLNSPKYDELIEKLKK"
     MQQQEQQQGG MKVKVQRFGS YLSGMIMPNI GAFIAWGIIT ALFIPAGWFP NEQLNTLVSP        60
     MITYLLPLLI AYTGGKMIYD HRGGVVGATA AIGVIVGSDI PMFLGAMIMG PLGGYLIKQT       120
     DKLFKDKVKQ GFEMLINNFT AGIVGAALTI LAFYAIGPVV LTLNKLLAAG VEVIVHANLL       180
     PVASVFVEPA KVLFLNNAIN HGILSPIGIE QASQTGKSIL FLVEANPGPG LGILLAYMFF       240
     GKGSSKSTAP GAAIIHFFGG IHEIYFPYIL MKPALILAAI AGGASGLLTF TIFNAGLVAA       300
     ASPGSIIALM AMTPRGGYFG VLAGVLVAAA VSFIVSAVIL KSSKASEEDL AAATEKMQSM       360
     KGKKSQAAAA LEAEQAKAEE ASELSPESVN KIIFACDAGM GSSAMGASIL RNKVKKAELD       420
     ISVTNTAINN LPSDADIVIT HKDLTDRAKA KLPNATHISV DNFLNSPKYD ELIEKLKK         478
//

If you have problems or comments...

PBIL Back to PBIL home page