(data stored in ACNUC7421 zone)

EMBL: AL009126.MTLD

AL009126.MTLD        Location/Qualifiers
FT   CDS             451618..452739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BSU_03990"
FT                   /old_locus_tag="BSU03990"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.17"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 22014119, 23279188;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12207"
FT                   /db_xref="GOA:P42957"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG11216"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42957"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 22014119, 23279188"
FT                   /protein_id="CAB12207.2"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKE
FT                   YTVELAEEGRSSEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRNTANTLNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETVGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLVKSYGFKQTEHEQYIKKIIGRFENP
FT                   FISDDVTRVARSPLRKLGENDRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQA
FT                   LIEEKGYSGVLQEVCGIQSHEPLHAIILKKLNQ"
     MIALHFGAGN IGRGFIGALL HHSGYDVVFA DVNETMVSLL NEKKEYTVEL AEEGRSSEII        60
     GPVSAINSGS QTEELYRLMN EAALITTAVG PNVLKLIAPS IAEGLRRRNT ANTLNIIACE       120
     NMIGGSSFLK KEIYSHLTEA EQKSVSETVG FPNSAVDRIV PIQHHEDPLK VSVEPFFEWV       180
     IDESGFKGKT PVINGALFVD DLTPYIERKL FTVNTGHAVT AYVGYQRGLK TVKEAIDHPE       240
     IRRVVHSALL ETGDYLVKSY GFKQTEHEQY IKKIIGRFEN PFISDDVTRV ARSPLRKLGE       300
     NDRLVGPAKK IKEPNALAEG IAAALRFDFT GDPEAVELQA LIEEKGYSGV LQEVCGIQSH       360
     EPLHAIILKK LNQ                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page