(data stored in ACNUC7421 zone)

EMBL: AL009126.MTLF

AL009126.MTLF        Location/Qualifiers
FT   CDS             451185..451616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="BSU_03982"
FT                   /old_locus_tag="BSU03982"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IIA component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03982"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52549"
FT                   /db_xref="GOA:C0H3V2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V2"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAX52549.1"
FT                   /translation="MQVLAKENIKLNQTVSSKEEAIKLAGQTLIDNGYVTEDYISKMFE
FT                   REETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGNTAKVVFGIAGKNN
FT                   EHLDILSNIAIICSEEENIERLISAKSEEDLIAIFNEVN"
     MQVLAKENIK LNQTVSSKEE AIKLAGQTLI DNGYVTEDYI SKMFEREETS STFMGNFIAI        60
     PHGTEEAKSE VLHSGISIIQ IPEGVEYGEG NTAKVVFGIA GKNNEHLDIL SNIAIICSEE       120
     ENIERLISAK SEEDLIAIFN EVN                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page