(data stored in SCRATCH zone)

EMBL: AL009126.MURP

AL009126.MURP        Location/Qualifiers
FT   CDS             complement(189790..191157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murP"
FT                   /locus_tag="BSU_01680"
FT                   /old_locus_tag="BSU01680"
FT                   /product="N-acetylmuramic acid PTS permease-MurP subunit"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.192"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15060041, 15849754, 16850406,
FT                   10627040, 20400549, 22960854; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11944"
FT                   /db_xref="GOA:Q797S1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11567"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q797S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11944.3"
FT                   /translation="MSKENNYHHLAQKILELCGGKSNISSYTHCMTRLRITPYDESKAD
FT                   AQALRKLDGVLGVVEAETLQIILGTGVVNHVTAAFSKLVSAEEGADVKEAAAKKKADIN
FT                   RKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSADSQIAIILTVIGS
FT                   GLFTYLGILVGINASKEFGGTPALGALAGILIINPEIAKISLFGEELLPGRGGLIGVLF
FT                   AAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAITSGLLSI
FT                   LDIGGIAAGFILGATFLPLVVTGLHQGLTPVHMELINSIGNDPLLPILAMGGAGQVGAA
FT                   FAVFVKTKKTTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAY
FT                   FQVATIAIGVSGLPLSFLVLPSQIILYIVGLFISYAAGFLLTYAFGYKDEMASQFD"
     MSKENNYHHL AQKILELCGG KSNISSYTHC MTRLRITPYD ESKADAQALR KLDGVLGVVE        60
     AETLQIILGT GVVNHVTAAF SKLVSAEEGA DVKEAAAKKK ADINRKNATP FKLFLRKIAS       120
     IFIPLIPALV ASGLITGITK AIIQAGWLSA DSQIAIILTV IGSGLFTYLG ILVGINASKE       180
     FGGTPALGAL AGILIINPEI AKISLFGEEL LPGRGGLIGV LFAAIFIAYT EQFIRRFIPQ       240
     SLDIIVTPTV SLLITGIVTY VVFMPLGGFI SDAITSGLLS ILDIGGIAAG FILGATFLPL       300
     VVTGLHQGLT PVHMELINSI GNDPLLPILA MGGAGQVGAA FAVFVKTKKT TLRKAIAGGL       360
     PSGLLGIGEP LIFGVTLPLG RPFLTACLGA GIGGAFQAYF QVATIAIGVS GLPLSFLVLP       420
     SQIILYIVGL FISYAAGFLL TYAFGYKDEM ASQFD                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page