(data stored in ACNUC7421 zone)

EMBL: AL009126.MURQ

AL009126.MURQ        Location/Qualifiers
FT   CDS             complement(192051..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="BSU_01700"
FT                   /old_locus_tag="BSU01700"
FT                   /product="D-lactyl ether N-acetylmuramic-6-phosphate acid
FT                   etherase"
FT                   /function="16.13: Shape"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="4.2.1.126"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15983044, 20400549, 16452451;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11946"
FT                   /db_xref="GOA:Q45582"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="SubtiList:BG11570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45582"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11946.1"
FT                   /translation="MSEPLNLHRLTTESRNSQTVEIHKANTLGILKMINNEDMKVAAAV
FT                   QEVLPDIKTAVDCAYESFQNGGRLIYTGAGTSGRLGVMDAVECPPTYSVSPDQVIGIMA
FT                   GGPEAFLQAAEGIEDSEEAGAEDLRNIQLTSNDTVIAIAASGRTPYAAGALRYARKVGA
FT                   HTIALTCNENSAISKDADHSIEVVVGPEAITGSTRMKAATAHKMILNMISTAVMVKIGK
FT                   VYENLMVDVNVSNKKLKERAISIIQSLTNASYDTARYTLEQADHHVKTAIVMLKTSTDQ
FT                   KQAQTLLDEANGFIDKAIEHYHP"
     MSEPLNLHRL TTESRNSQTV EIHKANTLGI LKMINNEDMK VAAAVQEVLP DIKTAVDCAY        60
     ESFQNGGRLI YTGAGTSGRL GVMDAVECPP TYSVSPDQVI GIMAGGPEAF LQAAEGIEDS       120
     EEAGAEDLRN IQLTSNDTVI AIAASGRTPY AAGALRYARK VGAHTIALTC NENSAISKDA       180
     DHSIEVVVGP EAITGSTRMK AATAHKMILN MISTAVMVKI GKVYENLMVD VNVSNKKLKE       240
     RAISIIQSLT NASYDTARYT LEQADHHVKT AIVMLKTSTD QKQAQTLLDE ANGFIDKAIE       300
     HYHP                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page