(data stored in ACNUC7421 zone)

EMBL: AL009126.NADE

AL009126.NADE        Location/Qualifiers
FT   CDS             338288..339106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BSU_03130"
FT                   /old_locus_tag="BSU03130"
FT                   /product="ammonium-dependent NAD+ synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.1.5"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7890752, 9271869, 12682299,
FT                   19204287; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12107"
FT                   /db_xref="GOA:P08164"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="PDB:1EE1"
FT                   /db_xref="PDB:1FYD"
FT                   /db_xref="PDB:1IFX"
FT                   /db_xref="PDB:1IH8"
FT                   /db_xref="PDB:1KQP"
FT                   /db_xref="PDB:1NSY"
FT                   /db_xref="PDB:2NSY"
FT                   /db_xref="SubtiList:BG10694"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08164"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7890752, 9271869, 12682299, 19204287"
FT                   /protein_id="CAB12107.1"
FT                   /translation="MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSW
FT                   KFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDE
FT                   TELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK"
     MSMQEKIMRE LHVKPSIDPK QEIEDRVNFL KQYVKKTGAK GFVLGISGGQ DSTLAGRLAQ        60
     LAVESIREEG GDAQFIAVRL PHGTQQDEDD AQLALKFIKP DKSWKFDIKS TVSAFSDQYQ       120
     QETGDQLTDF NKGNVKARTR MIAQYAIGGQ EGLLVLGTDH AAEAVTGFFT KYGDGGADLL       180
     PLTGLTKRQG RTLLKELGAP ERLYLKEPTA DLLDEKPQQS DETELGISYD EIDDYLEGKE       240
     VSAKVSEALE KRYSMTEHKR QVPASMFDDW WK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page