(data stored in ACNUC7421 zone)

EMBL: AL009126.NAGZ

AL009126.NAGZ        Location/Qualifiers
FT   CDS             complement(186452..188380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagZ"
FT                   /locus_tag="BSU_01660"
FT                   /old_locus_tag="BSU01660"
FT                   /product="N-acetylglucosaminidase lipoprotein"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.52"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8063094, 20400549, 20826810,
FT                   23177201, 26963691; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11942"
FT                   /db_xref="GOA:P40406"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:3BMX"
FT                   /db_xref="PDB:3LK6"
FT                   /db_xref="PDB:3NVD"
FT                   /db_xref="PDB:4GYJ"
FT                   /db_xref="PDB:4GYK"
FT                   /db_xref="SubtiList:BG10832"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40406"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8063094, 20400549, 20826810, 23177201, 26963691"
FT                   /protein_id="CAB11942.1"
FT                   /translation="MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLD
FT                   EKLGQMLMPDFRNWQKEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQ
FT                   LTDDYQKASPKIPLMLSIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKE
FT                   LSALGINTDFSPVVDINNNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKH
FT                   FPGHGDTDVDSHYGLPLVSHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTY
FT                   KSKLDGSDILVPATLSKKVMTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVK
FT                   AGVDIALMPASVTSLKEEQKFARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMY
FT                   PARNSDSTKEKIAKAKKIVGSKQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIV
FT                   APYEEQTASIEQTIHDLIKRKKIKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVV
FT                   KNDPVVNDGVIDDTISDSSKWATVFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKA
FT                   LIAVYGFKGYANGRYLQPNIPAGVMAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLN
FT                   IKTGRPL"
     MRPVFPLILS AVLFLSCFFG ARQTEASASK RAIDANQIVN RMSLDEKLGQ MLMPDFRNWQ        60
     KEGESSPQAL TKMNDEVASL VKKYQFGGII LFAENVKTTK QTVQLTDDYQ KASPKIPLML       120
     SIDQEGGIVT RLGEGTNFPG NMALGAARSR INAYQTGSII GKELSALGIN TDFSPVVDIN       180
     NNPDNPVIGV RSFSSNRELT SRLGLYTMKG LQRQDIASAL KHFPGHGDTD VDSHYGLPLV       240
     SHGQERLREV ELYPFQKAID AGADMVMTAH VQFPAFDDTT YKSKLDGSDI LVPATLSKKV       300
     MTGLLRQEMG FNGVIVTDAL NMKAIADHFG QEEAVVMAVK AGVDIALMPA SVTSLKEEQK       360
     FARVIQALKE AVKNGDIPEQ QINNSVERII SLKIKRGMYP ARNSDSTKEK IAKAKKIVGS       420
     KQHLKAEKKL AEKAVTVLKN EQHTLPFKPK KGSRILIVAP YEEQTASIEQ TIHDLIKRKK       480
     IKPVSLSKMN FASQVFKTEH EKQVKEADYI ITGSYVVKND PVVNDGVIDD TISDSSKWAT       540
     VFPRAVMKAA LQHNKPFVLM SLRNPYDAAN FEEAKALIAV YGFKGYANGR YLQPNIPAGV       600
     MAIFGQAKPK GTLPVDIPSV TKPGNTLYPL GYGLNIKTGR PL                          642
//

If you have problems or comments...

PBIL Back to PBIL home page