(data stored in ACNUC7421 zone)

EMBL: AL009126.NASB

AL009126.NASB        Location/Qualifiers
FT   CDS             complement(360442..362757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BSU_03320"
FT                   /old_locus_tag="BSU03320"
FT                   /product="assimilatory nitrate reductase (electron transfer
FT                   subunit NasB)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.7.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7836289, 8799114, 9765565,
FT                   10940050, 10972836, 15028686, 24122235; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12126"
FT                   /db_xref="GOA:P42433"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7836289, 8799114, 9765565, 10940050, 10972836,
FT                   15028686, 24122235"
FT                   /protein_id="CAB12126.2"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRI
FT                   HFKDGSSLKADLIVMAAGVKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEH
FT                   NGTVYGLVAPLYEQGKALASHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTT
FT                   SIKIYDEQAGVYKKALFVDDKLAGVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPET
FT                   SGPLFESMPSSETICQCNTVTKGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVED
FT                   LLRYMTNSEYTKPASTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCST
FT                   CVPAIQYYLEMLYPGFVQPEPATEETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVS
FT                   ITHGQRLKLSGIKPADLPNMKKDLKMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIE
FT                   RQLEMLPLPAPISISLSCETDCTEAALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCV
FT                   TENEDSTAGMIKGLIQYYRETAHYLEGVHQWIDRLGIVHIREVLFEEDLRAQLLESLQT
FT                   DLSLIQNPTVETGAYKKG"
     MKKQRLVLAG NGMAGIRCIE EVLKLNRHMF EIVIFGSEPH PNYNRILLSS VLQGEASLDD        60
     ITLNSKDWYD KHGITLYTGE TVIQIDTDQQ QVITDRKRTL SYDKLIVATG SSPHILPIPG       120
     ADKKGVYGFR TIEDCQALMN MAQHFQKAAV IGAGLLGLEA AVGLQHLGMD VSVIHHSAGI       180
     MQKQLDQTAA RLLQTELEQK GLTFLLEKDT VSISGATKAD RIHFKDGSSL KADLIVMAAG       240
     VKPNIELAVS AGIKVNRGII VNDFMQTSEP NIYAVGECAE HNGTVYGLVA PLYEQGKALA       300
     SHICGVPCEE YQGSAPSAAL KIAGIDVWSA GKIQEDERTT SIKIYDEQAG VYKKALFVDD       360
     KLAGVILFGD TRDKQRLLDS LLKQRDISIA KKQIIEPETS GPLFESMPSS ETICQCNTVT       420
     KGAIEDAVHT NSLTTVEEVK HCTKATGSCG GCKPLVEDLL RYMTNSEYTK PASTPSFCSC       480
     TDFTEDDIIA ELQRRPFTNP AEVMNQLDWK TKNGCSTCVP AIQYYLEMLY PGFVQPEPAT       540
     EETCILIPQM YGGRTNAEQL RTIANIIEAY SIPDVSITHG QRLKLSGIKP ADLPNMKKDL       600
     KMPVYTNEHR HALQSIKACT CGQNRSIQQL AAQIERQLEM LPLPAPISIS LSCETDCTEA       660
     ALQDVGAIRT QAGWDIHIGG VRGTHARSGA LFCVTENEDS TAGMIKGLIQ YYRETAHYLE       720
     GVHQWIDRLG IVHIREVLFE EDLRAQLLES LQTDLSLIQN PTVETGAYKK G                771
//

If you have problems or comments...

PBIL Back to PBIL home page