(data stored in ACNUC7421 zone)

EMBL: AL009126.NASC

AL009126.NASC        Location/Qualifiers
FT   CDS             complement(358303..360435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /locus_tag="BSU_03310"
FT                   /old_locus_tag="BSU03310"
FT                   /product="assimilatory nitrate reductase (catalytic
FT                   subunit)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="1.7.99.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10972836, 15028686, 9765565;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12125"
FT                   /db_xref="GOA:P42434"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="SubtiList:BG11095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42434"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10972836, 15028686, 9765565"
FT                   /protein_id="CAB12125.2"
FT                   /translation="MTERLLRYFRDKQQDVQSEKTYDTQCPFCSMQCKMQLVEQTIVTR
FT                   KKYTAIGIDNPTTQGRLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKD
FT                   QVTMIQTEHGHDAMAVYGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAN
FT                   QTFGADRGLTNPLSDIPHTRVIILAGTNIAECQPTIMPYFEKAKENGAYFIAIDPRETA
FT                   TTKIADLHLKIKPGTDAALANGLVKIIIDEQLINEDFIQSRTNGFEELKQHTDSLDLND
FT                   IAEQTSVSLVDIRKAAVKFAKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKP
FT                   YSGYGAITGQGNGQGAREHGQKADQLPGYRSIENEEHRAHIAKVWGIHQDELPRKGVSA
FT                   YEMMEKINDGDIKGLFLMCSNPAVSSPNANLVKKALRRLTFFVAIDLFISETAKYADVI
FT                   LPASSYLEDEGTMTNVEGRVTLREASRPCPGEAKHDWQIICDLASALGKGRYFSYTSAE
FT                   DIFNELREASRGGIADYSGISYGRLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAA
FT                   LSVIPNEPPVPKEKPTADYPLYLTTGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQT
FT                   AATYNIEDRVLVKIESPRGSITVRSKLSEQIRKDTVFVPIHWADAQNVNDLIGEALDPA
FT                   CKMPGFKVCAVRIIPI"
     MTERLLRYFR DKQQDVQSEK TYDTQCPFCS MQCKMQLVEQ TIVTRKKYTA IGIDNPTTQG        60
     RLCIKGMNAH QHALNSSRIT RPLLKKNGEF MPVSWEEALN HIKDQVTMIQ TEHGHDAMAV       120
     YGSASITNEE AYLLGKFARV GLQTKYIDYN GRLCMSAAAT AANQTFGADR GLTNPLSDIP       180
     HTRVIILAGT NIAECQPTIM PYFEKAKENG AYFIAIDPRE TATTKIADLH LKIKPGTDAA       240
     LANGLVKIII DEQLINEDFI QSRTNGFEEL KQHTDSLDLN DIAEQTSVSL VDIRKAAVKF       300
     AKETSGMLFT ARGIEQQTDG TAAVKGFLNM VLITGKIGKP YSGYGAITGQ GNGQGAREHG       360
     QKADQLPGYR SIENEEHRAH IAKVWGIHQD ELPRKGVSAY EMMEKINDGD IKGLFLMCSN       420
     PAVSSPNANL VKKALRRLTF FVAIDLFISE TAKYADVILP ASSYLEDEGT MTNVEGRVTL       480
     REASRPCPGE AKHDWQIICD LASALGKGRY FSYTSAEDIF NELREASRGG IADYSGISYG       540
     RLRREGGIHW PCPESDHPGT GRLFTESFAH PDQKAALSVI PNEPPVPKEK PTADYPLYLT       600
     TGRVMSHYLT GVQTRKSAAL AARHFESFME IHPQTAATYN IEDRVLVKIE SPRGSITVRS       660
     KLSEQIRKDT VFVPIHWADA QNVNDLIGEA LDPACKMPGF KVCAVRIIPI                  710
//

If you have problems or comments...

PBIL Back to PBIL home page