(data stored in SCRATCH zone)

EMBL: AL009126.NASD

AL009126.NASD        Location/Qualifiers
FT   CDS             complement(355764..358181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BSU_03300"
FT                   /old_locus_tag="BSU03300"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10972836, 15028686, 9765565,
FT                   16428414, 22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12124"
FT                   /db_xref="GOA:P42435"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42435"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10972836, 15028686, 9765565, 16428414, 22103536"
FT                   /protein_id="CAB12124.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGL
FT                   RFKDGTSIEADLVVMAVGIRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPL
FT                   SQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNDPEKRQELNGRMNETLSVHKDPWKDFLEDKQTSKELFENVVTTS"
     MGKKQLVLVG NGMAGVRAIE EILSVAKDEF QITIFGAEPH PNYNRILLSK VLQGDTDIKD        60
     ITLNDWDWYE ENNIQLYTNE TVIKVDTENK TVITDADRIQ PYDELILATG SVPFILPIPG       120
     ADKKGVTAFR DIKDTDTMLA ASKQYKKAAV IGGGLLGLEA ARGLLNLGMD VSVIHLAPFL       180
     MERQLDATAG RLLQNELEKQ GMTFLLEKQT EEIVGDDRVE GLRFKDGTSI EADLVVMAVG       240
     IRPNTTLGAE SGIPVNRGII VNDYMQTEIP HIYAVGECAE HRGIAYGLVA PLYEQAKVLA       300
     KHMCGIETKP YEGSVLSTQL KVSGVEVFSA GDFNESEEKK AIKVFDEQDG IYKKIVLRGN       360
     QIVGAVLFGD SSEGNRLFSM IQKEADISET SKISILQPLS QEAGTSITAA MSDDEIICGC       420
     NGVSKGAIIQ AIQEKGCSST DEIKACTGAS RSCGGCKPLV EEILQHTLGS DFDASAQKEA       480
     ICGCTTLSRD EVVEEIKAKG LSHTREVMNV LGWKTPEGCS KCRPALNYYL GMINPTKYED       540
     DRTSRFVNER MHANIQKDGT YSVVPRMYGG VTNSTDLRKI ADVVDKYEIP LVKMTGGQRI       600
     DLIGVKKEDL PKVWEDLDMP SGYAYGKTLR TVKTCVGEQF CRFGTQDSMA LGIALEKKFE       660
     GLNTPHKVKM AVSACPRNCA ESGIKDLGVV GIDGGWELYV GGNGGTHLRA GDLLMKVKTN       720
     EEVLEYAGAY LQYYRETANY LERTSAWLER VGLSHVQSVL NDPEKRQELN GRMNETLSVH       780
     KDPWKDFLED KQTSKELFEN VVTTS                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page