(data stored in ACNUC7421 zone)

EMBL: AL009126.NASE

AL009126.NASE        Location/Qualifiers
FT   CDS             complement(355412..355732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BSU_03290"
FT                   /old_locus_tag="BSU03290"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10217486, 15028686, 9765565,
FT                   22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12123"
FT                   /db_xref="GOA:P42436"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="SubtiList:BG11097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42436"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10217486, 15028686, 9765565, 22103536"
FT                   /protein_id="CAB12123.1"
FT                   /translation="MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAI
FT                   ENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
     MVNKDVTKVC IGKIEELPEQ LGKTVYIEDK ELAVFKLSDG SIRAIENRCP HKGGVLAEGI        60
     VSGQYVFCPM HDWKISLEDG IVQEPDHGCV KTYETLIEGE HVYLVY                      106
//

If you have problems or comments...

PBIL Back to PBIL home page