(data stored in ACNUC7421 zone)

EMBL: AL009126.NASF

AL009126.NASF        Location/Qualifiers
FT   CDS             complement(353900..355351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BSU_03280"
FT                   /old_locus_tag="BSU03280"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9765565, 10217486, 15028686;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12122"
FT                   /db_xref="GOA:P42437"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="SubtiList:BG11098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42437"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9765565, 10217486, 15028686"
FT                   /protein_id="CAB12122.1"
FT                   /translation="MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKL
FT                   LEFASPDCQFIYCGKLPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEA
FT                   DALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEG
FT                   LARSVQTLVFYMGVKNLSYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQK
FT                   VQEHQITNPAIIVIGDIVNFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADL
FT                   IEWPKWRTENMPVNEEILRKIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAA
FT                   SEQAKTELEKRGFLVTAIQPDSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTH
FT                   MIQRTISESPLHMVICPNKLSVQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGF
FT                   TAVQEQDELLAFIHNQHAEKKLLHT"
     MIMKNGIVYF VGAGPGDPGL LTIKGKQALK EADVILYDRL ANPKLLEFAS PDCQFIYCGK        60
     LPNRHFMKQK EINALLVEKA LNGLTVVRLK GGDPSVFGRV GEEADALHEH GIRYEMVPGI       120
     TSGIAAPLYA GIPVTHRDFA SSFAMITAHD KSLKGTPNLD WEGLARSVQT LVFYMGVKNL       180
     SYICQQLISY GKSPSVPVIV IQWGTWGRQR SVKGTLENIQ QKVQEHQITN PAIIVIGDIV       240
     NFQTHSWFES KPLIGRHLMV VTHGEDEDPL ADKLRDSGAD LIEWPKWRTE NMPVNEEILR       300
     KIGTFEDVFF TSRRAVCEFF RALASQKIDI RQLTAKLSAA SEQAKTELEK RGFLVTAIQP       360
     DSEKRLVVGS RHAVENMQKH ESCSFYITHE NVIDDRFTHM IQRTISESPL HMVICPNKLS       420
     VQQLINGGEQ IGILPEPSAS RPPIVCIGDD SAAGIYGFTA VQEQDELLAF IHNQHAEKKL       480
     LHT                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page