(data stored in ACNUC7421 zone)

EMBL: AL009126.NATA

AL009126.NATA        Location/Qualifiers
FT   CDS             296429..297169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="BSU_02750"
FT                   /old_locus_tag="BSU02750"
FT                   /product="Na+ ABC efflux transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10356997, 17322186; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12069"
FT                   /db_xref="GOA:P46903"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46903"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10356997, 17322186"
FT                   /protein_id="CAB12069.1"
FT                   /translation="MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKT
FT                   TMLRMIASLLEPSQGVITVDGFDTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFG
FT                   RLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDE
FT                   PTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALE
FT                   SLYESERSEDLNYIFMSKLVRGIS"
     MITLTDCSRR FQDKKKVVKA VRDVSLTIEK GEVVGILGEN GAGKTTMLRM IASLLEPSQG        60
     VITVDGFDTV KQPAEVKQRI GVLFGGETGL YDRMTAKENL QYFGRLYGLN RHEIKARIED       120
     LSKRFGMRDY MNRRVGGFSK GMRQKVAIAR ALIHDPDIIL FDEPTTGLDI TSSNIFREFI       180
     QQLKREQKTI LFSSHIMEEV QALCDSVIMI HSGEVIYRGA LESLYESERS EDLNYIFMSK       240
     LVRGIS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page