(data stored in ACNUC7421 zone)

EMBL: AL009126.NATK

AL009126.NATK        Location/Qualifiers
FT   CDS             complement(294615..295571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natK"
FT                   /locus_tag="BSU_02730"
FT                   /old_locus_tag="BSU02730"
FT                   /product="two-component sensor histidine kinase [NatR]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 17322186; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12067"
FT                   /db_xref="GOA:P70954"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11997"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70954"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 17322186"
FT                   /protein_id="CAB12067.1"
FT                   /translation="MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLY
FT                   IWNTKRVWKHCSSGLCAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSAL
FT                   QARLSDQIDKLTQAEQHANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQY
FT                   SQYDRFLKGENAYVAGVLYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILE
FT                   NALDSAAEAREKAEIKLETSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHE
FT                   GMGTYIIQKLVKGAFGRLDFTYRHPIFRLEIKIPFQK"
     MITLFQCLYL ILFSFICYQG AAAFSHSTAA SWLAAALGAA AAGLYIWNTK RVWKHCSSGL        60
     CAWIAVIQVM SVGVVLIGTD IMPVLCVIAI FAGCEGLRIG QSALQARLSD QIDKLTQAEQ       120
     HANQMLIDVR SRNHDTMKHI TAIKSAQPKA DTQAYIQNWA DQYSQYDRFL KGENAYVAGV       180
     LYDFLEKARA SNVSVSLHMH TPLSSLPFSP ADQVSLVGNI LENALDSAAE AREKAEIKLE       240
     TSLRSGLYVL TCENSTPGMD PKVLDTIYQS FGRSTKNGAH EGMGTYIIQK LVKGAFGRLD       300
     FTYRHPIFRL EIKIPFQK                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page