(data stored in ACNUC7421 zone)

EMBL: AL009126.NDHF

AL009126.NDHF        Location/Qualifiers
FT   CDS             205409..206926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="BSU_01830"
FT                   /old_locus_tag="BSU01830"
FT                   /product="putative NADH dehydrogenase; prophage 1 region"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.6.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10658656, 15849754,
FT                   16850406, 17015645, 6816592, 7565865; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11959"
FT                   /db_xref="GOA:P39755"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="SubtiList:BG10949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39755"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11959.1"
FT                   /translation="MLVSLSLSSLLTLFFIMLMASGISGLLFLHPRVPLSFVRIHIGIL
FT                   ALPLLVSLLILANSGVSGNVGPWHLDSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRK
FT                   YFTLFTFTTGAASMTWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLF
FT                   LLSWFSLFFAMMWLFHATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWP
FT                   FQRWLVESIVAPTPVSAIMHAGLVNAGGIILTRFSPLFHGGIASIILLLLASISVLIGT
FT                   GISLVQVDYKRQLVGSTIGQMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVG
FT                   RHEVSTRTNERTSYLWVMAGRILSLVIGVAFWLTAPGDGYHLISALILGWSLSVSWDQL
FT                   VAFGEGRIGRIAGLTVLGGAALVYFIIHHLFYKWLHTTIFQSVQPPMSAVMIVVCLLLF
FT                   GSALGTWVARHRSSVFFAVLYLWLVRLGEAKPKSVESHPDYLKQYIS"
     MLVSLSLSSL LTLFFIMLMA SGISGLLFLH PRVPLSFVRI HIGILALPLL VSLLILANSG        60
     VSGNVGPWHL DSLACLMTFF VLAIGFIIQR FSVRYLMGDR SYRKYFTLFT FTTGAASMTW       120
     LSGDLRLMVL FWGATLVGLT LLIRLNSAWQ VASEAAKISG RLFLLSWFSL FFAMMWLFHA       180
     TGQWQLSLVV TNESLAGLGE WERTGIQLLI VLAVIIPAAQ WPFQRWLVES IVAPTPVSAI       240
     MHAGLVNAGG IILTRFSPLF HGGIASIILL LLASISVLIG TGISLVQVDY KRQLVGSTIG       300
     QMGFMLIQCA LGAYIAAIIH LILHGLFKAT LFLQAGSAVG RHEVSTRTNE RTSYLWVMAG       360
     RILSLVIGVA FWLTAPGDGY HLISALILGW SLSVSWDQLV AFGEGRIGRI AGLTVLGGAA       420
     LVYFIIHHLF YKWLHTTIFQ SVQPPMSAVM IVVCLLLFGS ALGTWVARHR SSVFFAVLYL       480
     WLVRLGEAKP KSVESHPDYL KQYIS                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page