(data stored in ACNUC7421 zone)

EMBL: AL009126.NFRAB

AL009126.NFRAB       Location/Qualifiers
FT   CDS             complement(438516..439265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrAB"
FT                   /locus_tag="BSU_03860"
FT                   /old_locus_tag="BSU03860"
FT                   /product="NADPH-FMN oxidoreductase (nitroreductase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.6.99.-"
FT                   /EC_number="1.5.1.39"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16229462, 9836433, 20862523;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12194"
FT                   /db_xref="GOA:P94424"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1ZCH"
FT                   /db_xref="SubtiList:BG12040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94424"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16229462, 9836433, 20862523"
FT                   /protein_id="CAB12194.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQ
FT                   VTVITVQDKERKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVI
FT                   GHPADRSAKKPRLPQEAVNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQ
FT                   SIASYYERLYYPHIREMLEKQGFKVEK"
     MNEVIKSLTD HRSIRSYTDE PVAQEQLDQI IEAVQSAPSS INGQQVTVIT VQDKERKKKI        60
     SELAGGQPWI DQAPVFLLFC ADFNRAKIAL EDLHDFKMEI TNGLESVLVG AVDAGIALGT       120
     ATAAAESLGL GTVPIGAVRG NPQELIELLE LPKYVFPLSG LVIGHPADRS AKKPRLPQEA       180
     VNHQETYLNQ DELTSHIQAY DEQMSEYMNK RTNGKETRNW SQSIASYYER LYYPHIREML       240
     EKQGFKVEK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page