(data stored in ACNUC7421 zone)

EMBL: AL009126.NUDT

AL009126.NUDT        Location/Qualifiers
FT   CDS             488314..488763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudT"
FT                   /locus_tag="BSU_04330"
FT                   /old_locus_tag="BSU04330"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15576788, 16513759;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12240"
FT                   /db_xref="GOA:P96590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="SubtiList:BG11956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96590"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12240.1"
FT                   /translation="MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAA
FT                   VREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGR
FT                   LPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK"
     MYTQGAFVIV LNESQQILLV KRKDVPLWDL PGGRVDPGES AEEAAVREIL EETGYNAALS        60
     AKIGVYQRPK FQDEQHLFFG SITGGQAMAD GTETAGLKWV SPGRLPLFMV PNRKRQINDF       120
     KNGAQDVNVT VKDSGLLAAI DLLKRRLGK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page