(data stored in ACNUC7421 zone)

EMBL: AL009126.OPUAA

AL009126.OPUAA       Location/Qualifiers
FT   CDS             321013..322269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="BSU_02980"
FT                   /old_locus_tag="BSU02980"
FT                   /product="L-proline betaine and betonicine ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7622480, 16225868, 16645306,
FT                   25012968; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12092"
FT                   /db_xref="GOA:P46920"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7622480, 16225868, 16645306, 25012968"
FT                   /protein_id="CAB12092.2"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGS
FT                   TVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   HQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEY
FT                   INAEGTNEQTQDPSAQEVK"
     MSVDEKPIKI KVEKVSKIFG KQTKKAVQML ANGKTKKEIL KATGSTVGVN QADFEVYDGE        60
     IFVIMGLSGS GKSTLVRMLN RLIEPTAGNI YIDGDMITNM SKDQLREVRR KKISMVFQKF       120
     ALFPHRTILE NTEYGLELQG VDKQERQQKA LESLKLVGLE GFEHQYPDQL SGGMQQRVGL       180
     ARALTNDPDI LLMDEAFSAL DPLIRKDMQD ELLDLHDNVG KTIIFITHDL DEALRIGDRI       240
     VLMKDGNIVQ IGTPEEILMN PSNEYVEKFV EDVDLSKVLT AGHIMKRAET VRIDKGPRVA       300
     LTLMKNLGIS SIYAVDKQKK LLGVIYASDA KKAAESDLSL QDILNTEFTT VPENTYLTEI       360
     FDVVSDANIP IAVVDEKQRM KGIVVRGALI GALAGNNEYI NAEGTNEQTQ DPSAQEVK         418
//

If you have problems or comments...

PBIL Back to PBIL home page