(data stored in ACNUC7421 zone)

EMBL: AL009126.PABA

AL009126.PABA        Location/Qualifiers
FT   CDS             84290..84874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BSU_00750"
FT                   /old_locus_tag="BSU00750"
FT                   /product="4-amino-4-deoxychorismate synthase; anthranilate
FT                   synthase (subunit II)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9098056, 16605270, 17114263,
FT                   24847778; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11851"
FT                   /db_xref="GOA:P28819"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="SubtiList:BG10138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28819"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11851.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPD
FT                   FLMISPGPCSPDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SDIEHDGKTIFEGLKNPLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIE
FT                   GVQFHPESIMTSFGKEMLRNFIETYRKEVIA"
     MILMIDNYDS FTYNLVQYLG ELGEELVVKR NDSITIDEIE ELSPDFLMIS PGPCSPDEAG        60
     ISLEAIKHFA GKIPIFGVCL GHQSIAQVFG GDVVRAERLM HGKTSDIEHD GKTIFEGLKN       120
     PLVATRYHSL IVKPETLPSC FTVTAQTKEG EIMAIRHNDL PIEGVQFHPE SIMTSFGKEM       180
     LRNFIETYRK EVIA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page