(data stored in ACNUC7421 zone)

EMBL: AL009126.PBTP

AL009126.PBTP        Location/Qualifiers
FT   CDS             434256..435014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtP"
FT                   /locus_tag="BSU_03820"
FT                   /old_locus_tag="BSU03820"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 19955416; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12190"
FT                   /db_xref="GOA:P94420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94420"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 19955416"
FT                   /protein_id="CAB12190.1"
FT                   /translation="MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLS
FT                   IMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYS
FT                   QGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPL
FT                   NNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEE
FT                   MIETSVLEEIYDMTIPIQTIDNQRIGVYFS"
     MVEVRNVSKQ YGGKVVLEET SVTIQKGKIT SFIGPNGAGK STLLSIMSRL IKKDSGEIYI        60
     DGQEIGACDS KELAKKMSIL KQANQINIRL TIKDLVSFGR FPYSQGRLTE EDWVHINQAL       120
     SYMKLEDIQD KYLDQLSGGQ CQRAFIAMVI AQDTDYIFLD EPLNNLDMKH SVEIMKLLKR       180
     LVEELGKTIV IVIHDINFAS VYSDYIVALK NGRIVKEGPP EEMIETSVLE EIYDMTIPIQ       240
     TIDNQRIGVY FS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page