(data stored in SCRATCH zone)

EMBL: AL009126.PCP

AL009126.PCP         Location/Qualifiers
FT   CDS             complement(286773..287420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BSU_02650"
FT                   /old_locus_tag="BSU02650"
FT                   /product="pyrrolidone-carboxylate (pyroglutamate)
FT                   peptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1362573, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12059"
FT                   /db_xref="GOA:P28618"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="SubtiList:BG10873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28618"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1362573, 28830929"
FT                   /protein_id="CAB12059.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPT
FT                   VFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPYIPQQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH"
     MRKKVLITGF DPFDKETVNP SWEAAKRLNG FETEEAIITA EQIPTVFRSA LDTLRQAIQK        60
     HQPDIVICVG QAGGRMQITP ERVAINLADA RIPDNEGHQP IDEEISPDGP AAYWTRLPVK       120
     RMTAKMKEHG IPAAVSYTAG TFVCNYLFYG LMDHISRTSP HIRGGFIHIP YIPQQTIDKT       180
     APSLSLDTIV RALRIAAVTA AQYDEDVKSP GGTLH                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page