(data stored in SCRATCH zone)

EMBL: AL009126.PDXS

AL009126.PDXS        Location/Qualifiers
FT   CDS             19062..19946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BSU_00110"
FT                   /old_locus_tag="BSU00110"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, synthase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.-.-.-"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14762015, 15771487, 15911615,
FT                   16157873, 17144654; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11787"
FT                   /db_xref="GOA:P37527"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:2NV1"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10075"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37527"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14762015, 15771487, 15911615, 16157873, 17144654"
FT                   /protein_id="CAB11787.1"
FT                   /translation="MAQTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEAMGVDYIDES
FT                   EVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVAMSEDELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
     MAQTGTERVK RGMAEMQKGG VIMDVINAEQ AKIAEEAGAV AVMALERVPA DIRAAGGVAR        60
     MADPTIVEEV MNAVSIPVMA KARIGHIVEA RVLEAMGVDY IDESEVLTPA DEEFHLNKNE       120
     YTVPFVCGCR DLGEATRRIA EGASMLRTKG EPGTGNIVEA VRHMRKVNAQ VRKVVAMSED       180
     ELMTEAKNLG APYELLLQIK KDGKLPVVNF AAGGVATPAD AALMMQLGAD GVFVGSGIFK       240
     SDNPAKFAKA IVEATTHFTD YKLIAELSKE LGTAMKGIEI SNLLPEQRMQ ERGW             294
//

If you have problems or comments...

PBIL Back to PBIL home page