(data stored in SCRATCH zone)

EMBL: AL009126.PDXT

AL009126.PDXT        Location/Qualifiers
FT   CDS             19968..20558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BSU_00120"
FT                   /old_locus_tag="BSU00120"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, glutamine amidotransferase subunit PdxT"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14585832, 14762015, 15771487,
FT                   17144654, 18271580, 26735940; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11788"
FT                   /db_xref="GOA:P37528"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1R9G"
FT                   /db_xref="PDB:2NV0"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37528"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14585832, 14762015, 15771487, 17144654, 18271580,
FT                   26735940"
FT                   /protein_id="CAB11788.1"
FT                   /translation="MLTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILP
FT                   GGESTTMRRLIDTYQFMEPLREFAAQGKPMFGTCAGLIILAKEIAGSDNPHLGLLNVVV
FT                   ERNSFGRQVDSFEADLTIKGLDEPFTGVFIRAPHILEAGENVEVLSEHNGRIVAAKQGQ
FT                   FLGCSFHPELTEDHRVTQLFVEMVEEYKQKALV"
     MLTIGVLGLQ GAVREHIHAI EACGAAGLVV KRPEQLNEVD GLILPGGEST TMRRLIDTYQ        60
     FMEPLREFAA QGKPMFGTCA GLIILAKEIA GSDNPHLGLL NVVVERNSFG RQVDSFEADL       120
     TIKGLDEPFT GVFIRAPHIL EAGENVEVLS EHNGRIVAAK QGQFLGCSFH PELTEDHRVT       180
     QLFVEMVEEY KQKALV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page