(data stored in SCRATCH zone)

EMBL: AL009126.PE447

AL009126.PE447       Location/Qualifiers
FT   CDS             complement(490546..490749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_04345"
FT                   /old_locus_tag="BSU04345"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90542.1"
FT                   /translation="MIRISMQGQMHLPLKQDAFVLLSVSSMAKSVPNTYTDHFMNSNML
FT                   KIHLFPKKKKKTRALRAPVFLK"
     MIRISMQGQM HLPLKQDAFV LLSVSSMAKS VPNTYTDHFM NSNMLKIHLF PKKKKKTRAL        60
     RAPVFLK                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page