(data stored in ACNUC7421 zone)

EMBL: AL009126.PHOD

AL009126.PHOD        Location/Qualifiers
FT   CDS             284011..285762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BSU_02620"
FT                   /old_locus_tag="BSU02620"
FT                   /product="secreted phosphodiesterase (endo-hydrolysis at
FT                   non-specific sites throughout the cell wall teichoic acid
FT                   polymer)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11719524, 12867413, 16698798,
FT                   19395490, 19616508, 21479178, 27780866; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12056"
FT                   /db_xref="GOA:P42251"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="PDB:2YEQ"
FT                   /db_xref="SubtiList:BG11174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42251"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11719524, 12867413, 16698798, 19395490, 19616508,
FT                   21479178, 27780866"
FT                   /protein_id="CAB12056.2"
FT                   /translation="MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTI
FT                   AQSVGAFEVNAAPNFSSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKW
FT                   EVAKDEHFRKIVRKGTEMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTL
FT                   PAPGANVPQMTFAFASCQQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTG
FT                   NVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKG
FT                   QSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDD
FT                   QANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSA
FT                   SPIYSMDSWDGYPAQRERVINFIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFG
FT                   AEFVGTSITSGGNGADKRADTDQILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPF
FT                   VTEPGAAISTRASFVYQKDQTGLRKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIK
FT                   KRAKITN"
     MAYDSRFDEW VQKLKEESFQ NNTFDRRKFI QGAGKIAGLS LGLTIAQSVG AFEVNAAPNF        60
     SSYPFTLGVA SGDPLSDSVV LWTRLAPDPL NGGGMPKQAV PVKWEVAKDE HFRKIVRKGT       120
     EMAKPSLAHS VHVEADGLEP NKVYYYRFKT GHELSPVGKT KTLPAPGANV PQMTFAFASC       180
     QQYEHGYYTA YKHMAKEKLD LVFHLGDYIY EYGPNEYVSK TGNVRTHNSA EIITLQDYRN       240
     RHAQYRSDAN LKAAHAAFPW VVTWDDHEVE NNYANKIPEK GQSVEAFVLR RAAAYQAYYE       300
     HMPLRISSLP NGPDMQLYRH FTYGNLASFN VLDTRQYRDD QANNDGNKPP SDESRNPNRT       360
     LLGKEQEQWL FNNLGSSTAH WNVLAQQIFF AKWNFGTSAS PIYSMDSWDG YPAQRERVIN       420
     FIKSKNLNNV VVLTGDVHAS WASNLHVDFE KTSSKIFGAE FVGTSITSGG NGADKRADTD       480
     QILKENPHIQ FFNDYRGYVR CTVTPHQWKA DYRVMPFVTE PGAAISTRAS FVYQKDQTGL       540
     RKVSSTTIQG GVKQSDEVEE DRFFSHNKAH EKQMIKKRAK ITN                         583
//

If you have problems or comments...

PBIL Back to PBIL home page