(data stored in ACNUC7421 zone)

EMBL: AL009126.POXB

AL009126.POXB        Location/Qualifiers
FT   CDS             488830..490554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BSU_04340"
FT                   /old_locus_tag="BSU04340"
FT                   /product="acetyl-phosphate generating pyruvate oxidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.3.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16291680, 16513748, 10220166,
FT                   23611909; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12241"
FT                   /db_xref="GOA:P96591"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="SubtiList:BG12063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96591"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12241.1"
FT                   /translation="MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLK
FT                   FIQTRHEEVAALAAAAEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   SSGEVGRDYFQEIKLEQMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSD
FT                   DLFAEKIKREPVYTSPVYIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELL
FT                   EFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPDDTPAIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEH
FT                   MQHWWNEIEKDETEATTPLKPQQVVARLQEAAADDAVLSVDVGTVTVWMARHFKMNANQ
FT                   DFIVSSWLATMGCGLPGAIAASLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVV
FT                   ILNNENLGMIEYEQQVKGNIDYVTKLQNVDYAAFAESCGAKGIKVTKAEELAPAFHEAL
FT                   HSDQPVVVDVMIGNEPPLPGKITYGQAKGFSKYMLKNFFENQKFEMPSLKKSLKRLF"
     MAHKTAGQAM TELLEQWGVD HVYGIPGDSI NEFIEELRHE RNQLKFIQTR HEEVAALAAA        60
     AEAKLTGKIG VCLSIAGPGA VHLLNGLYDA KADGAPVLAI AGQVSSGEVG RDYFQEIKLE       120
     QMFEDVAVFN REVHSAESLP DLLNQAIRTA YSKKGVAVLS VSDDLFAEKI KREPVYTSPV       180
     YIEGNLEPKK EQLVTCAQYI NNAKKPIILA GQGMKKAKRE LLEFADKAAA PIVVTLPAKG       240
     VVPDKHPHFL GNLGQIGTKP AYEAMEECDL LIMLGTSFPY RDYLPDDTPA IQLDSDPAKI       300
     GKRYPVTAGL VCDSALGLRE LTEYIERKED RRFLNACTEH MQHWWNEIEK DETEATTPLK       360
     PQQVVARLQE AAADDAVLSV DVGTVTVWMA RHFKMNANQD FIVSSWLATM GCGLPGAIAA       420
     SLSEPERQAI AVCGDGGFSM VMQDLPTAVK YKLPITVVIL NNENLGMIEY EQQVKGNIDY       480
     VTKLQNVDYA AFAESCGAKG IKVTKAEELA PAFHEALHSD QPVVVDVMIG NEPPLPGKIT       540
     YGQAKGFSKY MLKNFFENQK FEMPSLKKSL KRLF                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page