(data stored in SCRATCH zone)

EMBL: AL009126.PRKT

AL009126.PRKT        Location/Qualifiers
FT   CDS             73809..74825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkT"
FT                   /locus_tag="BSU_00660"
FT                   /old_locus_tag="BSU00660"
FT                   /product="serine/threonine-protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23634894, 24731262, 25278935;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11842"
FT                   /db_xref="GOA:P37562"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:6G4J"
FT                   /db_xref="SubtiList:BG10129"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37562"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23634894, 24731262, 25278935"
FT                   /protein_id="CAB11842.2"
FT                   /translation="MMNDALTSLACSLKPGTTIKGKWNGNTYTLRKQLGKGANGIVYLA
FT                   ETSDGHVALKVSDDSLSITSEVNVLKSFSKAQSVTMGPSFFDTDDAYIPSANTKVSFYA
FT                   MEYIKGPLLLKYVSDKGAEWIPVLMIQLLSSLSVLHQQGWIFGDLKPDNLIVTGPPARI
FT                   RCIDVGGTTKEGRAIKEYTEFYDRGYWGYGTRKAEPSYDLFAVAMIMINSVHKKEFKKT
FT                   NQPKEQLRSLIEGNPLLQKYKKALFSALNGDYQSADEMKKDMLDAGQKAAQRKQPIKAS
FT                   PQPATRQRQQKPRQGKITKTRYTPKQKPAKSGGLFETTLIVISVLALYFAYIIFFLI"
     MMNDALTSLA CSLKPGTTIK GKWNGNTYTL RKQLGKGANG IVYLAETSDG HVALKVSDDS        60
     LSITSEVNVL KSFSKAQSVT MGPSFFDTDD AYIPSANTKV SFYAMEYIKG PLLLKYVSDK       120
     GAEWIPVLMI QLLSSLSVLH QQGWIFGDLK PDNLIVTGPP ARIRCIDVGG TTKEGRAIKE       180
     YTEFYDRGYW GYGTRKAEPS YDLFAVAMIM INSVHKKEFK KTNQPKEQLR SLIEGNPLLQ       240
     KYKKALFSAL NGDYQSADEM KKDMLDAGQK AAQRKQPIKA SPQPATRQRQ QKPRQGKITK       300
     TRYTPKQKPA KSGGLFETTL IVISVLALYF AYIIFFLI                               338
//

If you have problems or comments...

PBIL Back to PBIL home page