(data stored in SCRATCH zone)

EMBL: AL009126.PRS

AL009126.PRS         Location/Qualifiers
FT   CDS             57745..58698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BSU_00510"
FT                   /old_locus_tag="BSU00510"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2169413, 3038693, 8522540,
FT                   22083279, 25890046; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11827"
FT                   /db_xref="GOA:P14193"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="PDB:1DKR"
FT                   /db_xref="PDB:1DKU"
FT                   /db_xref="PDB:1IBS"
FT                   /db_xref="SubtiList:BG10114"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14193"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2169413, 3038693, 8522540, 22083279, 25890046"
FT                   /protein_id="CAB11827.1"
FT                   /translation="MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGE
FT                   VQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEG
FT                   KNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKL
FT                   PEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS"
     MSNQYGDKNL KIFSLNSNPE LAKEIADIVG VQLGKCSVTR FSDGEVQINI EESIRGCDCY        60
     IIQSTSDPVN EHIMELLIMV DALKRASAKT INIVIPYYGY ARQDRKARSR EPITAKLFAN       120
     LLETAGATRV IALDLHAPQI QGFFDIPIDH LMGVPILGEY FEGKNLEDIV IVSPDHGGVT       180
     RARKLADRLK APIAIIDKRR PRPNVAEVMN IVGNIEGKTA ILIDDIIDTA GTITLAANAL       240
     VENGAKEVYA CCTHPVLSGP AVERINNSTI KELVVTNSIK LPEEKKIERF KQLSVGPLLA       300
     EAIIRVHEQQ SVSYLFS                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page