(data stored in ACNUC7421 zone)

EMBL: AL009126.PSD

AL009126.PSD         Location/Qualifiers
FT   CDS             248749..249540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BSU_02290"
FT                   /old_locus_tag="BSU02290"
FT                   /product="phosphatidylserine decarboxylase; 32 kDa
FT                   precursor processed into a 29 kDa protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 9422599;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12023"
FT                   /db_xref="GOA:P39822"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="SubtiList:BG11013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39822"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 9422599"
FT                   /protein_id="CAB12023.1"
FT                   /translation="MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKH
FT                   FRLNWDDVDGTAADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGIINPNQT
FT                   FTVKGKDYSFAELTGCKSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRS
FT                   YPVNQLGLKYGKDVLSKNYRFVYELNSGSRNVLMIPVGAMNINSIVQTNTRTELEIGEE
FT                   LGYFSFGSTVILVFEKDAFQPSAHLAEGQEVQVGELIGYEE"
     MFNTAVKILY RSLIELTNHR LSSYLIKGFC ESKISKPVIP LFSKHFRLNW DDVDGTAADY        60
     GSLSELFIRQ INLERRPVSK EAHAVVSPVD GVVQTVGIIN PNQTFTVKGK DYSFAELTGC       120
     KSADHQYNGG YFVVLYLSPR HYHRFHSPIS CRYQKLAELG NRSYPVNQLG LKYGKDVLSK       180
     NYRFVYELNS GSRNVLMIPV GAMNINSIVQ TNTRTELEIG EELGYFSFGS TVILVFEKDA       240
     FQPSAHLAEG QEVQVGELIG YEE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page