(data stored in SCRATCH zone)

EMBL: AL009126.PSSA

AL009126.PSSA        Location/Qualifiers
FT   CDS             247744..248277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BSU_02270"
FT                   /old_locus_tag="BSU02270"
FT                   /product="phosphatidylserine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.8.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 15743965,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12021"
FT                   /db_xref="GOA:P39823"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="SubtiList:BG11012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39823"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 15743965, 15849754, 16850406"
FT                   /protein_id="CAB12021.1"
FT                   /translation="MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFD
FT                   GMAARKLNAVSDMGRELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGML
FT                   RLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHF
FT                   KKHAAENLESGRWN"
     MNYIPCMITI GNFICGLLAI HSLLYHNIHS AVLFIFTGMF LDFFDGMAAR KLNAVSDMGR        60
     ELDSFADLVT FGVAPSMLAY SVALYTLPFI GILCALTYSI CGMLRLSKFN IEQSKLPTFI       120
     GMPIPFAGMC LVILSFTYNP ILLAIGTCGL SYLMVSKIKF PHFKKHAAEN LESGRWN          177
//

If you have problems or comments...

PBIL Back to PBIL home page