(data stored in SCRATCH zone)

EMBL: AL009126.PTH

AL009126.PTH         Location/Qualifiers
FT   CDS             59504..60070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BSU_00530"
FT                   /old_locus_tag="BSU00530"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.29"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8635758, 12100553, 12682299;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11829"
FT                   /db_xref="GOA:P37470"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="SubtiList:BG10116"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37470"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8635758, 12100553, 12682299"
FT                   /protein_id="CAB11829.1"
FT                   /translation="MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGL
FT                   YGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRT
FT                   KGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVD
FT                   KSVKACEASLSKPFLEVMNEFNAKV"
     MLVIAGLGNP GKNYENTRHN VGFMVIDQLA KEWNIELNQN KFNGLYGTGF VSGKKVLLVK        60
     PLTYMNLSGE CLRPLMDYYD VDNEDLTVIY DDLDLPTGKI RLRTKGSAGG HNGIKSLIQH       120
     LGTSEFDRIR IGIGRPVNGM KVVDYVLGSF TKEEAPEIEE AVDKSVKACE ASLSKPFLEV       180
     MNEFNAKV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page