(data stored in ACNUC7421 zone)

EMBL: AL009126.PURT

AL009126.PURT        Location/Qualifiers
FT   CDS             243892..245046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BSU_02230"
FT                   /old_locus_tag="BSU02230"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.2.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7496533; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12017"
FT                   /db_xref="GOA:P39771"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="SubtiList:BG10924"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39771"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7496533"
FT                   /protein_id="CAB12017.1"
FT                   /translation="MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVA
FT                   HNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTM
FT                   DREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSE
FT                   ADLESCWETAMEGGRVKNGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDY
FT                   IESWQPHDMTEQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGL
FT                   VTLVTQNLSEFALHVRAILGFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPK
FT                   TQVRVFGKPITKAGRRMAVALSAADSVETARENAKKALDQLILK"
     MYQSKKVLLL GSGELGKEVV IEAQRLGVQT VAVDSYEHAP AMQVAHNSYV VDMLDPEQIR        60
     TIIEKENPDL IVPEVEAIAT DELLKLEEEG FHVIPNARAA KLTMDREGIR RLAAETLGLA       120
     TAGYEFANTY DEFIQAAAQI GFPCVVKPLM SSSGKGQSVC RSEADLESCW ETAMEGGRVK       180
     NGRVIVEEFI PFESEITLLT VRAVNGTAFC EPIGHVQKDG DYIESWQPHD MTEQQIEEAK       240
     HIAKTITDEL GGYGLFGVEL FLAKDRVYFS EVSPRPHDTG LVTLVTQNLS EFALHVRAIL       300
     GFPITEITQL SPGASRPLKA PEELADYTVE GLENALAVPK TQVRVFGKPI TKAGRRMAVA       360
     LSAADSVETA RENAKKALDQ LILK                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page