(data stored in ACNUC7421 zone)

EMBL: AL009126.PUTB

AL009126.PUTB        Location/Qualifiers
FT   CDS             344551..345462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putB"
FT                   /locus_tag="BSU_03200"
FT                   /old_locus_tag="BSU03200"
FT                   /product="proline oxidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.5.5.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17536821, 2118500, 21840319,
FT                   22139509, 26735940; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12114"
FT                   /db_xref="GOA:P94390"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="SubtiList:BG12011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94390"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17536821, 2118500, 21840319, 22139509, 26735940"
FT                   /protein_id="CAB12114.1"
FT                   /translation="MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTI
FT                   RQLNSQGLSVTVDHLGEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDI
FT                   DMDLVYENMTKILQTAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLY
FT                   RTEKDIDDLDSLNPFLRLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIAT
FT                   HDDKMIDFTKQLAKEHGIANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGY
FT                   FMRRLAERPSNIAFAFKGMTKK"
     MITRDFFLFL SKSGFLNKMA RNWGSRVAAG KIIGGNDFNS SIPTIRQLNS QGLSVTVDHL        60
     GEFVNSAEVA RERTEECIQT IATIADQELN SHVSLKMTSL GLDIDMDLVY ENMTKILQTA       120
     EKHKIMVTID MEDEVRCQKT LDIFKDFRKK YEHVSTVLQA YLYRTEKDID DLDSLNPFLR       180
     LVKGAYKESE KVAFPEKSDV DENYKKIIRK QLLNGHYTAI ATHDDKMIDF TKQLAKEHGI       240
     ANDKFEFQML YGMRSQTQLS LVKEGYNMRV YLPYGEDWYG YFMRRLAERP SNIAFAFKGM       300
     TKK                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page