(data stored in ACNUC7421 zone)

EMBL: AL009126.PUTC

AL009126.PUTC        Location/Qualifiers
FT   CDS             345479..347026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putC"
FT                   /locus_tag="BSU_03210"
FT                   /old_locus_tag="BSU03210"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.88"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11418582, 17183215, 21840319,
FT                   22139509, 25355936; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12115"
FT                   /db_xref="GOA:P94391"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG12012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94391"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11418582, 17183215, 21840319, 22139509, 25355936"
FT                   /protein_id="CAB12115.2"
FT                   /translation="MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGER
FT                   VETEAKIVSINPADKEEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRA
FT                   AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGE
FT                   KNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLE
FT                   ESGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERV
FT                   IEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIK
FT                   PTIFADLDPKARLMQEEIFGPVVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIER
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
     MTTPYKHEPF TNFQDQNNVE AFKKALATVS EYLGKDYPLV INGERVETEA KIVSINPADK        60
     EEVVGRVSKA SQEHAEQAIQ AAAKAFEEWR YTSPEERAAV LFRAAAKVRR RKHEFSALLV       120
     KEAGKPWNEA DADTAEAIDF MEYYARQMIE LAKGKPVNSR EGEKNQYVYT PTGVTVVIPP       180
     WNFLFAIMAG TTVAPIVTGN TVVLKPASAT PVIAAKFVEV LEESGLPKGV VNFVPGSGAE       240
     VGDYLVDHPK TSLITFTGSR EVGTRIFERA AKVQPGQQHL KRVIAEMGGK DTVVVDEDAD       300
     IELAAQSIFT SAFGFAGQKC SAGSRAVVHE KVYDQVLERV IEITESKVTA KPDSADVYMG       360
     PVIDQGSYDK IMSYIEIGKQ EGRLVSGGTG DDSKGYFIKP TIFADLDPKA RLMQEEIFGP       420
     VVAFCKVSDF DEALEVANNT EYGLTGAVIT NNRKHIERAK QEFHVGNLYF NRNCTGAIVG       480
     YHPFGGFKMS GTDSKAGGPD YLALHMQAKT ISEMF                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page