(data stored in SCRATCH zone)

EMBL: AL009126.PXPA

AL009126.PXPA        Location/Qualifiers
FT   CDS             457023..457796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpA"
FT                   /locus_tag="BSU_04050"
FT                   /old_locus_tag="BSU04050"
FT                   /product="oxoprolinase subunit A"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12213"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="SubtiList:BG11227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 28830929"
FT                   /protein_id="CAB12213.3"
FT                   /translation="MFQIDLNCDLGESFGAYKIGLDQDILEYVTSANIACGFHAGDPSV
FT                   MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGL
FT                   HMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESELVKAGERIGLQTAN
FT                   EVFADRTYQSDGTLTPRSQPDALIESDDAAVTQVIKMVKEGAVKSQQGHDVSLKADTVC
FT                   IHGDGAHALTFAQKIRKQLKAAGIEVTAISEQRST"
     MFQIDLNCDL GESFGAYKIG LDQDILEYVT SANIACGFHA GDPSVMRKTV ALAAERGVKM        60
     GAHPGLPDLL GFGRRNMAIS PEEAYDLVVY QIGALSGFLK AEGLHMQHVK PHGALYNMAA       120
     VDQKLSDAIA KAVYKVDPGL ILFGLAESEL VKAGERIGLQ TANEVFADRT YQSDGTLTPR       180
     SQPDALIESD DAAVTQVIKM VKEGAVKSQQ GHDVSLKADT VCIHGDGAHA LTFAQKIRKQ       240
     LKAAGIEVTA ISEQRST                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page