(data stored in ACNUC7421 zone)

EMBL: AL009126.PXPB

AL009126.PXPB        Location/Qualifiers
FT   CDS             459867..460589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpB"
FT                   /locus_tag="BSU_04080"
FT                   /old_locus_tag="BSU04080"
FT                   /product="L-5-oxoprolinase (ATP-dependent) subunit B"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 18823995, 19040634,
FT                   20524093, 21050859, 21245531, 22277658, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12216"
FT                   /db_xref="GOA:P60495"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:2KWA"
FT                   /db_xref="PDB:2ZP2"
FT                   /db_xref="SubtiList:BG11231"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60495"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 18823995, 19040634, 20524093, 21050859,
FT                   21245531, 22277658, 28830929"
FT                   /protein_id="CAB12216.2"
FT                   /translation="MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPG
FT                   FIECIPAFTSLTVFYDMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEI
FT                   PVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAP
FT                   RKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIV
FT                   KFVRISEKDYHAYKEESN"
     MTVRYQIEQL GDSAMMIRFG EEINEQVNGI VHAAAAYIEE QPFPGFIECI PAFTSLTVFY        60
     DMYEVYKHLP QGISSPFESV KRDVEERLAE IAEDYEVNRR IVEIPVCYGG EFGPDLEEVA       120
     KINQLSPEEV IDIHTNGEYV VYMLGFAPGF PFLGGMSKRI AAPRKSSPRP SIPAGSVGIA       180
     GLQTGVYPIS TPGGWQLIGK TPLALFRPQE NPPTLLRAGD IVKFVRISEK DYHAYKEESN       240
//

If you have problems or comments...

PBIL Back to PBIL home page