(data stored in ACNUC7421 zone)

EMBL: AL009126.PXPC

AL009126.PXPC        Location/Qualifiers
FT   CDS             460592..461599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpC"
FT                   /locus_tag="BSU_04090"
FT                   /old_locus_tag="BSU04090"
FT                   /product="L-5-oxoprolinase (ATP-dependent) subunit C"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 18823995, 19040634,
FT                   20524093, 21050859, 21245531, 22277658, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04090"
FT                   /db_xref="EnsemblGenomes-Tr:CAE01447"
FT                   /db_xref="GOA:Q7WY77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="SubtiList:BG14193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WY77"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 18823995, 19040634, 20524093, 21050859,
FT                   21245531, 22277658, 28830929"
FT                   /protein_id="CAE01447.2"
FT                   /translation="MKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGN
FT                   GENEAGLEITMMGPGPSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENSTVSFG
FT                   PCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSALSQTI
FT                   LSRLSSQLGKQGFAAPKWSVSRGRFLPLKKNPVIRVLEGKQFAFFTEESKTRFYEEAFR
FT                   VTPQSDRMGYRLKGEPLELKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRI
FT                   AHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAVEREQHIKELKTRMKMEWLT"
     MKVLKPGLLT TVQDIGRTGY QKYGVLASGA MDTVSLRIAN LLIGNGENEA GLEITMMGPG        60
     PSFHFSKQTL IAVTGADFTL RINDEEAPLW KPVLIKENST VSFGPCKLGS RAYLAAAGGI       120
     EVPAVMESKS TYVRGSIGGL HGRALQKEDE LNIGEMSALS QTILSRLSSQ LGKQGFAAPK       180
     WSVSRGRFLP LKKNPVIRVL EGKQFAFFTE ESKTRFYEEA FRVTPQSDRM GYRLKGEPLE       240
     LKAPLEMVSE AVSFGTVQVP PDGNPIILLA DRQTTGGYPR IAHIISADLP IVSQIMPGEH       300
     VQFEPVSLQE AEALAVEREQ HIKELKTRMK MEWLT                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page