(data stored in ACNUC7421 zone)

EMBL: AL009126.PXPG

AL009126.PXPG        Location/Qualifiers
FT   CDS             457811..459025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpG"
FT                   /locus_tag="BSU_04060"
FT                   /old_locus_tag="BSU04060"
FT                   /product="5-oxoproline transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 9334321, 15849754,
FT                   16850406, 28830929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12214"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="SubtiList:BG11228"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12214.3"
FT                   /translation="MEQQKKTAGKKAGSWSLLMGAAFLMATSAIGPGFLTQTATFTNTL
FT                   AASFGFVILISIILDIFAQTNVWRIIAVSGKRGQEIANMVLPGLGYFIAILVVLGGLAF
FT                   NIGNIGGAGLGLQVLFGITPETGALISAVIAILIFVIKEAGKAMDRFTQIAGFVMIILT
FT                   VYVAATTAPPVGQAVANTFVPEHISIFAIVTLVGGTVGGYITFAGGHRLLDAGIKGKES
FT                   IPQVTKSSVVGILITSVMRIALFLAVLGVVSKGLHIDESNPAASVFKLAAGNVGYKIFG
FT                   LIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAFVTIGQPAKILV
FT                   LVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMAVMGIYTLCTQL
FT                   PQLWS"
     MEQQKKTAGK KAGSWSLLMG AAFLMATSAI GPGFLTQTAT FTNTLAASFG FVILISIILD        60
     IFAQTNVWRI IAVSGKRGQE IANMVLPGLG YFIAILVVLG GLAFNIGNIG GAGLGLQVLF       120
     GITPETGALI SAVIAILIFV IKEAGKAMDR FTQIAGFVMI ILTVYVAATT APPVGQAVAN       180
     TFVPEHISIF AIVTLVGGTV GGYITFAGGH RLLDAGIKGK ESIPQVTKSS VVGILITSVM       240
     RIALFLAVLG VVSKGLHIDE SNPAASVFKL AAGNVGYKIF GLIMWSAAIT SVIGAAYTSV       300
     SFFKTFSPKI EKNSRGIIIG FIVVSTLAFV TIGQPAKILV LVGSLNGLIL PIALGTLLVA       360
     AYKKNIVGDY KHPLWLTSTG ALVVIVMAVM GIYTLCTQLP QLWS                        404
//

If you have problems or comments...

PBIL Back to PBIL home page