(data stored in ACNUC7421 zone)

EMBL: AL009126.RADA

AL009126.RADA        Location/Qualifiers
FT   CDS             106096..107472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BSU_00870"
FT                   /old_locus_tag="BSU00870"
FT                   /product="DNA repair protein; 6-O-methylguanine-DNA
FT                   methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 10931349, 11810266,
FT                   15317759, 25616256; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11863"
FT                   /db_xref="GOA:P37572"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="SubtiList:BG10149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37572"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11863.1"
FT                   /translation="MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANR
FT                   RAAFSHSVQTVQKPSPITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLSGSSNSVLYISGEESVKQTKLRADRLGINNPSLHVLSETDMEYISSAI
FT                   QEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGSAGSSITASMEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIVISIASSFRDTPPNPADCFIGEVGL
FT                   TGEVRRVSRIEQRVKEAAKLGFKRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG
FT                   "
     MAKTKSKFIC QSCGYESPKW MGKCPGCGAW NTMVEEMIKK APANRRAAFS HSVQTVQKPS        60
     PITSIETSEE PRVKTQLGEF NRVLGGGVVK GSLVLIGGDP GIGKSTLLLQ VSAQLSGSSN       120
     SVLYISGEES VKQTKLRADR LGINNPSLHV LSETDMEYIS SAIQEMNPSF VVVDSIQTVY       180
     QSDITSAPGS VSQVRECTAE LMKIAKTKGI PIFIVGHVTK EGSIAGPRLL EHMVDTVLYF       240
     EGERHHTFRI LRAVKNRFGS TNEMGIFEMR EEGLTEVLNP SEIFLEERSA GSAGSSITAS       300
     MEGTRPILVE IQALISPTSF GNPRRMATGI DHNRVSLLMA VLEKRVGLLL QNQDAYLKVA       360
     GGVKLDEPAI DLAIVISIAS SFRDTPPNPA DCFIGEVGLT GEVRRVSRIE QRVKEAAKLG       420
     FKRMIIPAAN LDGWTKPKGI EVIGVANVAE ALRTSLGG                               458
//

If you have problems or comments...

PBIL Back to PBIL home page