(data stored in SCRATCH zone)

EMBL: AL009126.RAEA

AL009126.RAEA        Location/Qualifiers
FT   CDS             116025..116537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raeA"
FT                   /locus_tag="BSU_00970"
FT                   /old_locus_tag="BSU00970"
FT                   /product="ribosome-dependent mRNA endonuclease"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17114934, 23355615, 28363943;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11873"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="PDB:5MQ8"
FT                   /db_xref="PDB:5MQ9"
FT                   /db_xref="SubtiList:BG10158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37574"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17114934, 23355615, 28363943"
FT                   /protein_id="CAB11873.1"
FT                   /translation="MDILLVDGYNMIGAWPQLKDLKANSFEEARDVLIQKMAEYQSYTG
FT                   NRVIVVFDAHLVKGLEKKQTNHRVEVIFTKENETADERIEKLAQALNNIATQIHVATSD
FT                   YTEQWAIFGQGALRKSARELLREVETIERRIERRVRKITSEKPAGKIALSEEVLKTFEK
FT                   WRRGDLD"
     MDILLVDGYN MIGAWPQLKD LKANSFEEAR DVLIQKMAEY QSYTGNRVIV VFDAHLVKGL        60
     EKKQTNHRVE VIFTKENETA DERIEKLAQA LNNIATQIHV ATSDYTEQWA IFGQGALRKS       120
     ARELLREVET IERRIERRVR KITSEKPAGK IALSEEVLKT FEKWRRGDLD                  170
//

If you have problems or comments...

PBIL Back to PBIL home page