(data stored in ACNUC7421 zone)

EMBL: AL009126.RAPC

AL009126.RAPC        Location/Qualifiers
FT   CDS             428831..429979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapC"
FT                   /locus_tag="BSU_03770"
FT                   /old_locus_tag="BSU03770"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10464187, 12456319, 12897006,
FT                   12950917, 15968044, 19202088; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12185"
FT                   /db_xref="GOA:P94415"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="SubtiList:BG11966"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94415"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10464187, 12456319, 12897006, 12950917, 15968044,
FT                   19202088"
FT                   /protein_id="CAB12185.1"
FT                   /translation="MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQ
FT                   HDSNLLLYYSLMEFRHQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYV
FT                   NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLI
FT                   NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLV
FT                   GRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDK
FT                   ASEYHKRGYEYAKETDDADYAVKFEFLQSLYLDQPNEEGIERCFQYLKNKNMYADIEDL
FT                   ALEVAKYYYEQKWFKLSASYFLQVEEARKQIQRSEGLYEIEI"
     MKSGVIPSSA VGQKINEWYR YIRTFSVPDA EVLKAEIQQE LKHMQHDSNL LLYYSLMEFR        60
     HQLMLDYLEP LEKLNIEDQP SLSELSRNID SNQADLKGLL DYYVNFFRGM YEFDKREFIS       120
     AITYYKQAEK KLSFVADHIE RAEFYFKIAE AYYYMKQTYF SLINIKNAYE IYVEQETYNV       180
     RIIQCHFVFG VNLMDERNFE QAARHFKLAL NMAQAEQKAQ LVGRAYYNLG LCYYNQDLLD       240
     PAIDYFEKAV STFESSRIVN SLPQAYFLIT LIYYKQGKHD KASEYHKRGY EYAKETDDAD       300
     YAVKFEFLQS LYLDQPNEEG IERCFQYLKN KNMYADIEDL ALEVAKYYYE QKWFKLSASY       360
     FLQVEEARKQ IQRSEGLYEI EI                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page