(data stored in ACNUC7421 zone)

EMBL: AL009126.RAPJ

AL009126.RAPJ        Location/Qualifiers
FT   CDS             304430..305551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapJ"
FT                   /locus_tag="BSU_02820"
FT                   /old_locus_tag="BSU02820"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16816200; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12076"
FT                   /db_xref="GOA:O34327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4GYO"
FT                   /db_xref="SubtiList:BG12663"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34327"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16816200"
FT                   /protein_id="CAB12076.1"
FT                   /translation="MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEE
FT                   NQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYF
FT                   RGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYAS
FT                   QALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAA
FT                   YYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEA
FT                   YDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDT
FT                   AERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ"
     MRAKIPSEEV AVKLNEWYKL IRAFEADQAE ALKQEIEYDL EDMEENQDLL LYFSLMEFRH        60
     RIMLDKLMPV KDSDTKPPFS DMLNEIESNQ QKLTGLLEYY FYYFRGMYEF KQKNFILAID       120
     HYKHAEEKLE YVEDEIEKAE FLFKVAEVYY HIKQTYFSMN YASQALDIYT KYELYGRRRV       180
     QCEFIIAGNL TDVYHHEKAL THLCSALEHA RQLEEAYMIA AAYYNVGHCK YSLGDYKEAE       240
     GYFKTAAAIF EEHNFQQAVQ AVFSLTHIYC KEGKYDKAVE AYDRGIKSAA EWEDDMYLTK       300
     FRLIHELYLG SGDLNVLTEC FDLLESRQLL ADAEDLLHDT AERFNQLEHY ESAAFFYRRL       360
     MNIKKKLAEQ RFQ                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page