(data stored in SCRATCH zone)

EMBL: AL009126.RIBZ

AL009126.RIBZ        Location/Qualifiers
FT   CDS             456068..456817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribZ"
FT                   /locus_tag="BSU_04040"
FT                   /old_locus_tag="BSU04040"
FT                   /product="5-amino-6-ribitylamino-2,4(1H,
FT                   3H)-pyrimidinedione 5'-phosphate phosphatase / 5'
FT                   nucleotidase"
FT                   /function="4.9: Riboflavin, FMN, and FAD"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.3.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 26316208, 27435445,
FT                   27784292; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12212"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="SubtiList:BG11226"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12212.2"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKNKELEITNS
FT                   SPTNIEVNALGINKAAALAKVTEKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
     MSVQREDVDI KLIAIDMDGT LLNDEQLISD ENRKAIREAE DKGVYVVIST GRTLMTCREL        60
     AESLKLSSFL ITANGSEIWD SNFNLVERKL LHTDHIQMMW DLRNKHNTNF WASTVNKVWR       120
     GEFPENITDH EWLKFGFDIE DDDIRNEVLE ELRKNKELEI TNSSPTNIEV NALGINKAAA       180
     LAKVTEKLGF TMENVMAMGD SLNDIAMIKE AGLGVAMGNA QDIVKETADY ITDTNIEDGV       240
     AKAIRHWVL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page